KIAA0825 Rabbit Polyclonal Antibody

CAT#: TA331407

Rabbit polyclonal Anti-C5orf36 Antibody

 Product Datasheet for 'TA331407'

USD 360.00

5 Days

    • 100 ul

Product images


Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-C5orf36 antibody: synthetic peptide directed towards the N terminal of human C5orf36. Synthetic peptide located within the following region: CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 37kDa
Gene Name KIAA0825
Background The specific function of C5orf36 is not yet known.
Synonyms C5orf36
Note Pig: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Dog: 93%; Guinea pig: 93%; Bovine: 86%; Rat: 79%; Rabbit: 77%
Reference Data
Other products for "KIAA0825"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones