DAND5 Rabbit Polyclonal Antibody

CAT#: TA331393

Reviews ()
Write a review

Rabbit Polyclonal Anti-DAND5 Antibody


 Product Datasheet for 'TA331393'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DAND5 antibody is: synthetic peptide directed towards the N-terminal region of Human DAND5. Synthetic peptide located within the following region: SGALPTGSGRPEPQSPRPQSWAAANQTWALGPGALPPLVPASALGSWKAF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 21 kDa
Gene Name DAN domain BMP antagonist family member 5
Background This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. In mouse, this protein has been shown to bind Nodal and to inhibit the Nodal signaling pathway which patterns left/right body asymmetry.
Synonyms CER2; CERL2; CKTSF1B3; COCO; CRL2; DANTE; GREM3; SP1
Note Human: 100%
Reference Data
Other products for "DAND5"
Frequently bought together (2)
Transient overexpression lysate of DAN domain family, member 5 (DAND5)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
68 Mouse Clones