PLEKHA3 Rabbit Polyclonal Antibody

CAT#: TA331348

Rabbit Polyclonal Anti-PLEKHA3 Antibody

Product Images

WB Suggested Anti-PLEKHA3 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PLEKHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human PLEKHA3. Synthetic peptide located within the following region: DTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: pleckstrin homology domain containing A3
• Database Link:
  NP_061964
  Entrez Gene 65977 Human
  UniProt ID Q9HB20
• Background: PLEKHA3 binds specifically to phosphatidylinositol 4-phosphate (PtdIns4P), but not to other phosphoinositides.
• Synonyms: FAPP1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Guinea pig: 93%