RFESD Rabbit Polyclonal Antibody

CAT#: TA330957

Rabbit polyclonal Anti-RFESD Antibody

Product Images

WB Suggested Anti-RFESD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RFESD antibody: synthetic peptide directed towards the middle region of human RFESD. Synthetic peptide located within the following region: VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: Rieske Fe-S domain containing
• Database Link:
  NP_775498
  Entrez Gene 317671 Human
  UniProt ID Q8TAC1
• Background: The specific function of this protein remains unknown.
• Synonyms: Rieske (Fe-S) domain containing
• Note: Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%