TMEM146 (CATSPERD) Rabbit Polyclonal Antibody

CAT#: TA330925

Reviews ()
Write a review

Rabbit polyclonal Anti-TMEM146 Antibody



Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 375.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TMEM146 antibody: synthetic peptide directed towards the middle region of human TMEM146. Synthetic peptide located within the following region: NPHSLGFQATFYENGYTSDGNTKYKLDIFLKQQQHWGRTDSNFTSSLKKA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 90 kDa
Gene Name cation channel sperm associated auxiliary subunit delta
Background TMEM146 is a single-pass type I membrane protein. The functions of TMEM146 remain unknown.
Synonyms TMEM146
Note Human: 100%; Pig: 83%; Horse: 83%
Reference Data
Protein Families Transmembrane
Other products for "CATSPERD"
Frequently bought together (2)
Transient overexpression lysate of transmembrane protein 146 (TMEM146)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies