SPATA48 Rabbit Polyclonal Antibody

CAT#: TA330847

Rabbit Polyclonal Anti-C7orf72 Antibody

Product Images

Host: Rabbit; Target Name: C7orf72; Sample Tissue: ACHN Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C7orf72 antibody is: synthetic peptide directed towards the N-terminal region of Human C7orf72. Synthetic peptide located within the following region: PHYCDLLRKMNMPFVKGLENRHNYGRFEKKCNPAFLKFHPYPPSVLPDYH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 48 kDa
• Gene Name: chromosome 7 open reading frame 72
• Database Link:
  NP_001155306
  Entrez Gene 100130988 Human
• Background: The function of this protein remains unknown.
• Synonyms: C7orf72
• Note: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 92%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Rat: 85%