AARSD1 (PTGES3L-AARSD1) Rabbit Polyclonal Antibody

CAT#: TA330771

Rabbit Polyclonal Anti-PTGES3L-AARSD1 Antibody

Product Images

Host: Rabbit; Target Name: PTGES3L-AARSD1; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PTGES3L-AARSD1 antibody is: synthetic peptide directed towards the C-terminal region of Human PTGES3L-AARSD1. Synthetic peptide located within the following region: LLFLTVGDEKGGGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: PTGES3L-AARSD1 readthrough
• Database Link:
  NP_079543
  Entrez Gene 100885850 Human
  UniProt ID Q9BTE6
• Background: This locus represents naturally occurring readthrough transcription between the neighboring PTGES3L (prostaglandin E synthase 3 (cytosolic)-like) and AARSD1(alanyl-tRNA synthetase domain containing 1) genes on chromosome 17. The readthrough transcript encodes a fusion protein that shares sequence identity with each individual gene product.
• Synonyms: MGC2744
• Note: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 79%