CGBP (CXXC1) Rabbit Polyclonal Antibody

CAT#: TA330630

Rabbit Polyclonal Anti-CXXC1 Antibody

Product Images

WB Suggested Anti-CXXC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: THP-1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CXXC1 antibody: synthetic peptide directed towards the middle region of human CXXC1. Synthetic peptide located within the following region: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 76 kDa
• Gene Name: CXXC finger protein 1
• Database Link:
  NP_055408
  Entrez Gene 30827 Human
  UniProt ID Q9P0U4
• Background: Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression. Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 [PubMed 11604496]). [supplied by OMIM]
• Synonyms: 2410002I16Rik; 5830420C16Rik; CFP1; CGBP; hCGBP; HsT2645; PCCX1; PHF18; SPP1; ZCGPC1
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 92%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors