CGBP (CXXC1) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of CXXC finger 1 (PHD domain) (CXXC1), transcript variant 2
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "CGBP"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CXXC1 antibody: synthetic peptide directed towards the middle region of human CXXC1. Synthetic peptide located within the following region: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 76 kDa |
Gene Name | CXXC finger protein 1 |
Database Link | |
Background | Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression. Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001 [PubMed 11604496]). [supplied by OMIM] |
Synonyms | 2410002I16Rik; 5830420C16Rik; CFP1; CGBP; hCGBP; HsT2645; PCCX1; PHF18; SPP1; ZCGPC1 |
Note | Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 92%; Mouse: 92% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.