TRIM45 Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of tripartite motif-containing 45 (TRIM45), transcript variant 1
USD 665.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "TRIM45"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the N terminal of human TRIM45. Synthetic peptide located within the following region: FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 64 kDa |
Gene Name | tripartite motif containing 45 |
Database Link | |
Background | TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described. TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis (Wang et al., 2004 [PubMed 15351693]). [supplied by OMIM] |
Synonyms | RNF99 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.