PACSIN1 Rabbit Polyclonal Antibody

CAT#: TA330001

Rabbit Polyclonal Anti-PACSIN1 Antibody

Product Images

WB Suggested Anti-PACSIN1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:62500; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PACSIN1 antibody: synthetic peptide directed towards the C terminal of human PACSIN1. Synthetic peptide located within the following region: HTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: protein kinase C and casein kinase substrate in neurons 1
• Database Link:
  NP_065855
  Entrez Gene 29993 Human
  UniProt ID Q9BY11
• Background: PACSIN1 may play a role in vesicle formation and transport.
• Synonyms: SDPI
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 100%; Rabbit: 92%; Dog: 85%; Goat: 85%; Horse: 85%; Pig: 85%

Reference Data

• Protein Families: Druggable Genome