ZNF543 Rabbit Polyclonal Antibody

CAT#: TA329918

Reviews ()
Write a review

Rabbit Polyclonal Anti-ZNF543 Antibody



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF543 antibody: synthetic peptide directed towards the middle region of human ZNF543. Synthetic peptide located within the following region: SSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSEC
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 68 kDa
Gene Name zinc finger protein 543
Background ZNF543, a gene located on chromosome 19, encodes a zinc finger protein.
Synonyms DKFZp434H055; MGC119382; MGC119384
Note Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Pig: 85%; Mouse: 83%; Guinea pig: 79%
Reference Data
Other products for "ZNF543"
Frequently bought together (2)
Transient overexpression lysate of zinc finger protein 543 (ZNF543)
    • 100 ug

USD 550.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies