CRTR1 (TFCP2L1) Rabbit Polyclonal Antibody

CAT#: TA329694

Rabbit Polyclonal Anti-TFCP2L1 Antibody

Product Images

WB Suggested Anti-TFCP2L1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: TFCP2L1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: TFCP2L1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  Human Spermatophore

• 

  Human Muscle

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFCP2L1 antibody: synthetic peptide directed towards the N terminal of human TFCP2L1. Synthetic peptide located within the following region: LRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: transcription factor CP2-like 1
• Database Link:
  NP_055368
  Entrez Gene 29842 Human
  UniProt ID Q9NZI6
• Background: TFCP2L1 is a candidate CP2 family member. It is expressed in a developmentally regulated fashion in vivo and acts as a direct repressor of transcription. CP2-related proteins comprise a family of DNA-binding transcription factors that are generally activators of transcription and expressed ubiquitously.
• Synonyms: CRTR1; LBP-9; LBP9
• Note: Immunogen sequence homology: Dog: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 75%

Reference Data

• Protein Families: Transcription Factors