Hey L (HEYL) Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of hairy/enhancer-of-split related with YRPW motif-like (HEYL)
USD 436.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "Hey L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HEYL antibody: synthetic peptide directed towards the N terminal of human HEYL. Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | hes related family bHLH transcription factor with YRPW motif-like |
Database Link | |
Background | HEYL belongs to hairy-related bHLH transcription factor family. HEY genes are candidates for several human or mouse disease loci. |
Synonyms | bHLHb33; HESR3; HEY3; HRT3 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 92%; Bovine: 92%; Horse: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.