GBX2 Rabbit Polyclonal Antibody

CAT#: TA329429

Reviews ()
Write a review

Rabbit Polyclonal anti-GBX2 antibody



USD 410.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GBX2 antibody: synthetic peptide directed towards the middle region of human GBX2. Synthetic peptide located within the following region: QGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 37 kDa
Gene Name gastrulation brain homeobox 2
Background Altered expression of GBX2, part of the homeobox-containing human family of DNA-binding transcription factors, is associated with therapy failure and death in patients with multiple types of cancer.
Synonyms gastrulation brain homeo box 2; gastrulation brain homeobox 2
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Mouse: 85%
Reference Data
Other products for "GBX2"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.