HOXA5 Rabbit Polyclonal Antibody

CAT#: TA329289

Rabbit Polyclonal anti-HOXA5 antibody

Product Images

WB Suggested Anti-HOXA5 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate

• 

  Human kidney

• 

  Sample Type : Mouse dorsal skin -5d postnatalPrimary Antibody Dilution : 1:200Secondary Antibody : Anti-rabbit-HRPSecondary Antibody Dilution : 1:500Color/Signal Descriptions : Brown: HOXA5Gene Name : HOXA5Submitted by : Alexander Awgulewitsch, Ph.D.Associate Professor - Dept. of MedicineDirector - MUSC Transgenic Mouse Core Medical University of South Carolina (MUSC)96 Jonathan Lucas St. / Suite 912 CSBCharleston, SC 29425

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the middle region of human HOXA5. Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: homeobox A5
• Database Link:
  NP_061975
  Entrez Gene 15402 MouseEntrez Gene 3202 Human
  UniProt ID P20719
• Background: In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
• Synonyms: HOX1; HOX1.3; HOX1C
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%

Reference Data

• Protein Families: Transcription Factors