HOXA5 Rabbit Polyclonal Antibody

CAT#: TA329289

Reviews ()
Write a review

Rabbit Polyclonal anti-HOXA5 antibody



USD 396.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivity Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HOXA5 antibody: synthetic peptide directed towards the middle region of human HOXA5. Synthetic peptide located within the following region: VGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDNIGG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name homeobox A5
Background In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.
Synonyms HOX1; HOX1.3; HOX1C
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%
Reference Data
Protein Families Transcription Factors
Other products for "HOXA5"
Frequently bought together (2)
Transient overexpression lysate of homeobox A5 (HOXA5)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 186.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies