KCNB2 Mouse Monoclonal Antibody [Clone ID: N372B/1]
Specifications
| Product Data | |
| Clone Name | N372B/1 |
|---|---|
| Application | IF, IHC, WB |
| Recommended Dilution | Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC) |
| Reactivity | Human, Mouse, Rat |
| Antibody Host | Mouse |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Immunogen | Fusion protein amino acids 717-907 (cytoplasmic C-terminus) of rat Kv2.2 long isoform (also known as Potassium voltage-gated channel subfamily B member 2, Kcnb2 and CDRK, accession number NP_446452.2) Mouse: 94% identity (180/191 amino acids identical). Human: 84% identity (161/191 amino acids identical). <50% identity with Kv2.1 and other Kv2 channels. 100% identity with Kv2.2 short isoform for first 47 amino acids (ENRGSAPQTPPSTARPLPVTTADFPLTTPQHMSTILLEEALPQGQRP). |
| Specificity | Does not cross-react with Kv2.2 short isoform. Does not cross-react with Kv2.1. |
| Buffer | State: Purified |
| Conjugation | Unconjugated |
| Shipping | Blue Ice |
| Synonyms | Voltage-gated potassium channel subunit Kv2.2 |
| Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
| Reference Data | |
Reviews
Documents
| Product Manuals |
| FAQs |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.