Reep2 Mouse Monoclonal Antibody [Clone ID: N326D/13]
Specifications
| Product Data | |
| Clone Name | N326D/13 |
|---|---|
| Application | IF, IHC, WB |
| Recommended Dilution | Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC) |
| Reactivity | Mouse, Rat |
| Antibody Host | Mouse |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Immunogen | Fusion protein amino acids 111-254 (cytoplasmic C-terminus) of mouse REEP2 (also known as Receptor expression-enhancing protein 2, C5orf19, SGC32445 and LOC682105, accession number Q8VCD6). Rat: 97% identity (140/144 amino acids identical) Human: 86% identity (125/144 amino acids identical) <40% identity with REEP1 and REEP4 but >65% identity for first 46 amino acids (RDKSYETMMRVGKRGLNLAANAAVTAAAKGQGVLSEKLRSFSMQDL) |
| Specificity | Cross-reacts with REEP1. Cross-reacts with other unidentified proteins. |
| Buffer | State: Purified |
| Conjugation | Unconjugated |
| Shipping | Blue Ice |
| Gene Name | receptor accessory protein 2 |
| Database Link | |
| Synonyms | C5orf19; SGC32445 |
| Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
| Reference Data | |
Reviews
Documents
| Product Manuals |
| FAQs |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.