Svop Mouse Monoclonal Antibody [Clone ID: N356/23]
Specifications
| Product Data | |
| Clone Name | N356/23 |
|---|---|
| Application | IF, WB |
| Recommended Dilution | Immunoblot (IB) Immunocytochemistry (ICC) |
| Reactivity | Mouse, Rat |
| Antibody Host | Mouse |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Immunogen | Fusion protein amino acids 1-85 (MEEDLFQLRQLPVVKFRRTGESARSEDDAASGEHDVQIEGVRVGLEAVELDDGAAVPKEFANPTDDTFMVEDAVEAIGFGRFQWK, cytoplasmic N-terminus) of rat SVOP (also known as Synaptic vesicle 2-related protein and SV2-related protein, accession number Q9Z2I7). Mouse: 97% identity (83/85 amino acids identical) Human: 95% identity (81/85 amino acids identical) <20% overall identity with SVOPL/SVOP2 but >80% identity (14/16 amino acids) near C-terminus (TFMVEDAVEAIGFGRF) |
| Specificity | Does not cross-react with SVOPL/SVOP2 |
| Buffer | State: Purified |
| Conjugation | Unconjugated |
| Shipping | Blue Ice |
| Gene Name | SV2 related protein |
| Database Link | |
| Synonyms | SV2-related protein |
| Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
| Reference Data | |
Reviews
Documents
| Product Manuals |
| FAQs |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.