BAF53b (ACTL6B) Mouse Monoclonal Antibody [Clone ID: N332B/15]

SKU 75-311

BAF53b (ACTL6B) mouse monoclonal antibody, clone N332B/15

Product Data

• Clone Name: N332B/15
• Application: IF, IHC, WB
• Recommended Dilution: Immunoblot (IB); Immunohistochemistry (IHC); Immunocytochemistry (ICC)
• Reactivity: Human, Mouse, Rat
• Antibody Host: Mouse
• Isotype: IgG1
• Clonality: Monoclonal
• Immunogen: Fusion protein amino acids 39-114 (TTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNL, actin subdomain 2) of human BAF53b (also known as 53 kDa BRG1-associated factor B, BRG1-associated factor 53B, Actin-like protein 6B, ArpNalpha, ACTL6B and ACTL6, accession number O94805).; Mouse: 98% identity (75/76 amino acids identical).; Rat: 98% identity (75/76 amino acids identical).; >50% identity with BAF53a.
• Specificity: Does not cross-react with BAF53a
• Buffer: State: Purified
• Conjugation: Unconjugated
• Shipping: Blue Ice
• Gene Name: actin like 6B
• Database Link:
  O94805
• Synonyms: ACTL6, BAF53B, Actin-like protein 6B, ArpNalpha
• Note: USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:; "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."; Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.; View Research License Agreement

Reference Data