Abcc9 (Isoform SUR2A) Mouse Monoclonal Antibody [Clone ID: N319A/14]
Specifications
| Product Data | |
| Clone Name | N319A/14 |
|---|---|
| Application | IF, IHC, WB |
| Recommended Dilution | Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC) |
| Reactivity | Mouse, Rat |
| Antibody Host | Mouse |
| Isotype | IgG2a |
| Clonality | Monoclonal |
| Immunogen | Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170). Rat: 97% identity (41/42 amino acids identical). Human: 92% identity (39/42 amino acids identical). 100% identity with SUR2C. <50% identity with SUR2B. |
| Specificity | Does not cross-react with SUR2B |
| Buffer | State: Purified |
| Conjugation | Unconjugated |
| Shipping | Blue Ice |
| Gene Name | ATP-binding cassette, sub-family C (CFTR/MRP), member 9 |
| Database Link | |
| Synonyms | Sulfonylurea receptor 2 |
| Note | USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement |
| Reference Data | |
| Atlas Protein Categories | Cardiovascular diseases, Membrane Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |