OriGene Logo

Abcc9 (Isoform SUR2A) Mouse Monoclonal Antibody [Clone ID: N319A/14]

Be the first to review this product
SKU
75-296
Abcc9 (Isoform SUR2A) mouse monoclonal antibody, clone N319A/14
Size:
100 ul
Conjugation:
Unconjugated
  $700.00
3 Weeks*
Size
Bulk/Customize

View other "Abcc9" antibodies

Specifications
Specifications
Product Data
Clone Name N319A/14
Application IF, IHC, WB
Recommended Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immunocytochemistry (ICC)
Reactivity Mouse, Rat
Antibody Host Mouse
Isotype IgG2a
Clonality Monoclonal
Immunogen Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170).
Rat: 97% identity (41/42 amino acids identical).
Human: 92% identity (39/42 amino acids identical).
100% identity with SUR2C.
<50% identity with SUR2B.
Specificity Does not cross-react with SUR2B
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Database Link
Synonyms Sulfonylurea receptor 2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Atlas Protein Categories Cardiovascular diseases, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.