OriGene Logo

Kcnmb2 Mouse Monoclonal Antibody [Clone ID: N53/32]

Be the first to review this product
SKU
75-087
Kcnmb2 mouse monoclonal antibody, clone N53/32
Size:
100 ul
Conjugation:
Unconjugated
  $700.00
3 Weeks*
Size
Bulk/Customize

View other "Kcnmb2" antibodies

Specifications
Specifications
Product Data
Clone Name N53/32
Application IF, IP, WB
Recommended Dilution Immunoblot (IB)
Immunocytochemistry (ICC)
Immunoprecipitation (IP)
Reactivity Human, Mouse, Rat
Antibody Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen Fusion protein amino acids 1-41 (MFIWTSGRTSSSYRQDEKRNIYQKIRDHDLLDKRKTVTALK, cytoplasmic N-terminus) and 218-235 (KLTQYLSLLCERIQRINR, cytoplasmic C-terminus) of mouse BKBeta2 (also known as BK channel subunit beta-2, Calcium-activated potassium channel subunit beta-2, Calcium-activated potassium channel, subfamily M subunit beta-2, Charybdotoxin receptor subunit beta-2, K(VCA)beta-2, Maxi K channel subunit beta-2, Slobeta-2 and Kcnmb2, accession number Q9CZM9).
Human: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively)
Rat: 97% and 100% identity (40/41 and 18/18 amino acids identical, respectively)
<50% identity with other BKBeta subunits
Specificity No cross-reactivity against BKBeta1, BKBeta3 or BKBeta4
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name potassium large conductance calcium-activated channel, subfamily M, beta member 2
Database Link
Synonyms BKbeta2, Hbeta2, Hbeta3, K(VCA)beta-2, Slo-beta-2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.