OriGene Logo

Scn1a Mouse Monoclonal Antibody [Clone ID: K74/71]

Be the first to review this product
SKU
75-023
Scn1a mouse monoclonal antibody, clone K74/71
Size:
100 ul
Conjugation:
Unconjugated
  $800.00
3 Weeks*
Size
Bulk/Customize

View other "Scn1a" antibodies

Specifications
Specifications
Product Data
Clone Name K74/71
Application IF, IHC, IP, WB
Recommended Dilution Immunoblot (IB).
Immunohistochemistry (IHC).
Immunocytochemistry (ICC).
Immunoprecipitation (IP).
Reactivity Human, Mouse, Rat
Antibody Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen Fusion protein amino acids 1929-2009 (cytoplasmic C-terminus, HLLKRTVKQASFTY NKNKLKGGANLLVKEDMIIDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK) of rat Voltage-gated sodium channel subunit alpha Nav1.1 (also known as Sodium channel protein type 1 subunit alpha, Sodium channel protein brain I subunit alpha, Scn1a, NAC1 and SCN1, accession number P04774).
Mouse: 98% identity (80/81 amino acids identical).
Human: 97% identity (79/81 amino acids identical).
~50% identity with Nav1.2 and Nav1.3.
Specificity Does not cross-react with Nav1.2 or Nav1.3.
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name sodium voltage-gated channel alpha subunit 1
Database Link
Synonyms NAC1, SCN1
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.