OriGene Logo

Kv1.2 (KCNA2) Mouse Monoclonal Antibody [Clone ID: K14/16]

Be the first to review this product
SKU
75-008
Kv1.2 (KCNA2) mouse monoclonal antibody, clone K14/16
Size:
100 ul
Conjugation:
Unconjugated
  $800.00
2 Weeks*
Size
Bulk/Customize

View other "KCNA2" antibodies

Specifications
Specifications
Product Data
Clone Name K14/16
Application IF, IHC, IP, WB
Recommended Dilution Immunoblot, Immunocytochemistry, Immunohistochemistry and Immunoprecipitation.
Reactivity Human, Mouse, Rat, Xenopus, Zebrafish
Antibody Host Mouse
Isotype IgG2b
Clonality Monoclonal
Immunogen Fusion protein amino acids 428-499 (QYLQVTSCPKIPSSPDLKKSRSASTISKSDYMEIQEGVNNSN EDFREENLKTANCTLANTNYVNITKMLTDV, cytoplasmic C-terminus) of human Kv1.2 (also known as Potassium voltage-gated channel subfamily A member 2, Voltage-gated K(+) channel HuKIV or HBK5, Kcna2, NGK1, RAK, RBK2, RCK5 and MK2, accession number P16389), epitope mapped to within underlined sequence (amino acids 463-480).
Mouse: 100% identity (72/72 amino acids identical)
Rat: 100% identity (72/72 amino acids identical)
Some identity with Kv1.1, Kv1.3 and Kv1.4
Specificity No cross-reactivity against Kv1.1, Kv1.3, Kv1.4, Kv1.5 or Kv1.6
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name potassium voltage-gated channel subfamily A member 2
Database Link
Synonyms Potassium voltage-gated channel subfamily A member 2, Voltage-gated potassium channel subunit Kv1.2, HBK5, NGK1, HUKIV, KCNA2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.