OriGene Logo

Gria2 Mouse Monoclonal Antibody [Clone ID: L21/32]

Be the first to review this product
SKU
75-002
Gria2 mouse monoclonal antibody, clone L21/32
Size:
100 ul
Conjugation:
Unconjugated
  $800.00
3 Weeks*
Size
Bulk/Customize

View other "Gria2" antibodies

Specifications
Specifications
Product Data
Clone Name L21/32
Application IHC, WB
Recommended Dilution Immunoblot (IB)
Immunohistochemistry (IHC)
Immuno-gold EM
Reactivity Human, Mouse, Rat
Antibody Host Mouse
Isotype IgG1
Clonality Monoclonal
Immunogen Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGY NVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 (also known as Glutamate receptor 2, AMPA-selective glutamate receptor 2, Glutamate receptor ionotropic AMPA 2, GluR-B, GluR-K2 and Gria2, accession number P19491).
Mouse: 98% identity (49/50 amino acids identical)
Human: 98% identity (49/50 amino acids identical) 100% identity between Flip and Flop isoforms
>70% identity with GluA3/GluR3 and less identity with GluA1/GluR1 and GluA4/GluR4
Buffer State: Purified
Conjugation Unconjugated
Shipping Blue Ice
Gene Name glutamate ionotropic receptor AMPA type subunit 2
Database Link
Synonyms GluR-B, GluR-K2, Glutamate receptor ionotropic, AMPA2, GRIA2
Note USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows:
"The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616."
Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity.
View Research License Agreement
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.