OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All XCL1 Proteins

XCL1 (NM_002995) Purified Human Protein

Specifications Citations (0) Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723277 Purified recombinant protein of Human chemokine (C motif) ligand 1 (XCL1)., 20 µg (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Tag:Tag-free Predicted MW:10 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: Determined by its ability to chemoattract human T cells using a concentration of 10.0-100.0 ng/ml.
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: Cytokine-cytokine receptor interactionChemokine signaling pathway
Protein Data
Protein Image
 

Reference Data
RefSeq: NP_002986 RefSeq Size: 1222 RefSeq ORF: 345
LocusID: 6375 Cytogenetic: 1q23  
Synonyms : ATAC; LPTN; LTN; SCM-1; SCM-1a; SCM1; SCM1A; SCYC1
Summary: This gene encodes a member of the chemokine superfamily. Chemokines function in inflammatory and immunological responses, inducing leukocyte migration and activation. The encoded protein is a member of the C-chemokine subfamily, retaining only two of four cysteines conserved in other chemokines, and is thought to be specifically chemotactic for T cells. This gene and a closely related family member are located on the long arm of chromosome 1. [provided by RefSeq, Nov 2010].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company
All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title