OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All IL6 Proteins

IL6 (NM_000600) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723240 Purified recombinant protein of Human interleukin 6 (interferon, beta 2) (IL6)., 20ug (Larger pack size?) 199
$139
5 Days
Add to Shopping Cart
spacer
Also for IL6 (NM_000600)
cDNA Clone shRNA/siRNA Primer Pair Lysate Antibody

OriGene Data
Species:Human Expression Host:E. coli
Expression cDNA Clone or AA Sequence
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Tag:Tag-free Predicted MW:20.9 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: ED50 as determined by the dose-dependent stimulation of the proliferation of IL-6 dependent murine 7TD1 cells is less than or equal to 0.1 ng/ml, corresponding to a specific activity of > 1 x 10^7units/mg.
Protein Families: Secreted ProteinDruggable Genome
Protein Pathways: Cytokine-cytokine receptor interactionToll-like receptor signaling pathwayNOD-like receptor signaling pathwayCytosolic DNA-sensing pathwayJak-STAT signaling pathwayHematopoietic cell lineageMore Pathways >>
Protein Data
Protein Image
 

Reference Data
RefSeq: NP_000591 RefSeq Size: 1125 RefSeq ORF: 639
LocusID: 3569 Cytogenetic: 7p21  
Synonyms : BSF2; HGF; HSF; IFNB2; IL-6
Summary: This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. [provided by RefSeq, Jun 2011].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company Copyright © 2014 OriGene Technologies, Inc. All Rights Reserved. Legal Notices.
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 • 1.888.267.4436

Reproduction of any materials from this website is strictly forbidden without permission.

All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title