OriGene Technologies, Inc.
Search:    
Left ProductsProducts divider ServicesServices divider technologyTechnology divider researchResearch divider TechsupportTechSupport divider AboutAbout Right
 
Home Recombinant Human Proteins All ICAM1 Proteins

ICAM1 (NM_000201) Purified Human Protein

Specifications Citations Customer Service Product Documents
Cat. No. Description Datasheet Price Availability*  
TP723160 Purified recombinant protein of Human intercellular adhesion molecule 1 (ICAM1)., 50ug (Larger pack size?) 399
$239
5 Days
Add to Shopping Cart
spacer
Also for ICAM1 (NM_000201)
cDNA Clone shRNA/siRNA Primer Pair Lysate Antibody

OriGene Data
Species:Human Expression Host:CHO cells
Expression cDNA Clone or AA Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Tag:Tag-free Predicted MW:49.5 kDa
Purity:>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration:Resuspend the protein in the desired concentration in proper buffer
Buffer:Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
BioActivity: ICAM-1 supported the adhesion of more than 50% PMA-stimulated HSB2 cells to plates coated at 25ug/mL ICAM-1 concentration.
Protein Families: ES Cell Differentiation/IPSTransmembraneDruggable Genome
Protein Pathways: Cell adhesion molecules (CAMs)Natural killer cell mediated cytotoxicityLeukocyte transendothelial migrationViral myocarditis
 

Reference Data
RefSeq: NP_000192 RefSeq Size: 2986 RefSeq ORF: 1599
LocusID: 3383 Cytogenetic: 19p13.3  
Synonyms : BB2; CD54; P3.58
Summary: This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008].
*: Inventory for certain proteins may be limited due to low expression level. Delivery time may vary from web posted schedule. Contact techsupport@origene.com for specific inventory information
**: DDK-tag is the same as FLAG tag. Flag® is a registered trademark of Sigma-Aldrich

 

bar
Inc 5000 Healthcare Company Copyright © 2014 OriGene Technologies, Inc. All Rights Reserved. Legal Notices.
9620 Medical Center Dr., Suite 200, Rockville, MD 20850 • 1.888.267.4436

Reproduction of any materials from this website is strictly forbidden without permission.

All Products by: Title | Price | Category | Popularity | Best Sellers Topselling Products by: Title | Price | Category | Popularity | Favorites
Popular Categories: Popularity | Our Choices | All-Round Favorites | Title Topselling Categories: Popularity | Our Choices | All-Round Favorites | Title