FADS2 (NM_004265) Human Recombinant Protein
CAT#: TP323780
Recombinant protein of human fatty acid desaturase 2 (FADS2), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223780 representing NM_004265
Red=Cloning site Green=Tags(s) MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATD AFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHVFFLLLLAHI IALESIAWFTVFYFGNGWIPTLITAFVLATSQAQAGWLQHDYGHLSVYRKPKWNHLVHKFVIGHLKGASA NWWNHRHFQHHAKPNIFHKDPDVNMLHVFVLGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQ YQIIMTMIVHKNWVDLAWAVSYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQE AYRDWFSSQLTATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIIRSLKKSGKLWLDAYLHK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 52.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004256 |
Locus ID | 9415 |
UniProt ID | O95864 |
Cytogenetics | 11q12.2 |
Refseq Size | 3149 |
Refseq ORF | 1332 |
Synonyms | D6D; DES6; FADSD6; LLCDL2; SLL0262; TU13 |
Summary | The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
Protein Families | Transmembrane |
Protein Pathways | alpha-Linolenic acid metabolism, Biosynthesis of unsaturated fatty acids, PPAR signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418107 | FADS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY418107 | Transient overexpression lysate of fatty acid desaturase 2 (FADS2) |
USD 665.00 |
|
PH323780 | FADS2 MS Standard C13 and N15-labeled recombinant protein (NP_004256) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review