APOBEC3G (NM_021822) Human Recombinant Protein
CAT#: TP306821
Recombinant protein of human apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G (APOBEC3G), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206821 protein sequence
Red=Cloning site Green=Tags(s) MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRF FHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQ KRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEP WVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVT CFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068594 |
Locus ID | 60489 |
UniProt ID | Q9HC16 |
Cytogenetics | 22q13.1 |
Refseq Size | 1848 |
Refseq ORF | 1152 |
Synonyms | A3G; ARCD; ARP-9; ARP9; bK150C2.7; CEM-15; CEM15; dJ494G10.1; MDS019 |
Summary | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. [provided by RefSeq, Mar 2017] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411904 | APOBEC3G HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411904 | Transient overexpression lysate of apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G (APOBEC3G) |
USD 436.00 |
|
PH306821 | APOBEC3G MS Standard C13 and N15-labeled recombinant protein (NP_068594) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review