SAT2 (NM_133491) Human Recombinant Protein

CAT#: TP304044

Recombinant protein of human spermidine/spermine N1-acetyltransferase family member 2 (SAT2), 20 µg

Product Images

Coomassie blue staining of purified SAT2 protein (Cat# TP304044). The protein was produced from HEK293T cells transfected with SAT2 cDNA clone (Cat# RC204044) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204044 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC
  VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY
  KALGAQDLTEAEGWHFFCFQGEATRKLAGK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 19 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_597998
• Locus ID: 112483
• UniProt ID: Q96F10
• Cytogenetics: 17p13.1
• Refseq Size: 983
• Refseq ORF: 510
• Synonyms: SSAT2
• Summary: Enzyme which catalyzes the acetylation of polyamines. Substrate specificity: norspermidine > spermidine = spermine >> N(1)acetylspermine = putrescine.[UniProtKB/Swiss-Prot Function]
• Protein Pathways: Arginine and proline metabolism, Metabolic pathways