Cystathionase (CTH) (NM_001902) Human Recombinant Protein
CAT#: TP302195
Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202195 protein sequence
Red=Cloning site Green=Tags(s) MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC LEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI KLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGADISMYSA TKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFL ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001893 |
Locus ID | 1491 |
UniProt ID | P32929 |
Cytogenetics | 1p31.1 |
Refseq Size | 2140 |
Refseq ORF | 1215 |
Summary | This gene encodes a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in this gene cause cystathioninuria. Alternative splicing of this gene results in three transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010] |
Protein Pathways | Cysteine and methionine metabolism, Glycine, serine and threonine metabolism, Metabolic pathways, Nitrogen metabolism, Selenoamino acid metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419669 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC434190 | CTH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419669 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1 |
USD 436.00 |
|
LY434190 | Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3 |
USD 436.00 |
|
PH302195 | CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review