EPCAM (NM_002354) Human Recombinant Protein
CAT#: TP301989
Recombinant protein of human epithelial cell adhesion molecule (EPCAM), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201989 representing NM_002354
Red=Cloning site Green=Tags(s) MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA TRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 32.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002345 |
Locus ID | 4072 |
UniProt ID | P16422 |
Cytogenetics | 2p21 |
Refseq Size | 1528 |
Refseq ORF | 942 |
Synonyms | DIAR5; EGP-2; EGP40; EGP314; ESA; HNPCC8; KS1/4; KSA; M4S1; MIC18; MK-1; TACSTD1; TROP1 |
Summary | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008] |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400847 | EPCAM HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400847 | Transient overexpression lysate of epithelial cell adhesion molecule (EPCAM) |
USD 436.00 |
|
PH301989 | EPCAM MS Standard C13 and N15-labeled recombinant protein (NP_002345) |
USD 3,255.00 |
|
TP710374 | Purified recombinant protein of Human epithelial cell adhesion molecule (EPCAM), esidues 24-265aa, secretory expressed with GP67 signal peptide, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
|
TP720296 | Recombinant protein of human epithelial cell adhesion molecule (EPCAM) |
USD 330.00 |
|
TP721349 | Human Trop1/EpCAM Protein (C-His) |
USD 258.00 |
|
TP721350 | Human Trop1/EpCAM Protein (C-His-Avi) |
USD 258.00 |
|
TP721351 | Biotinylated Human Trop1/EpCAM Protein (C-His-Avi) |
USD 366.00 |
|
TP721352 | PE Conjugated Human Trop1/EpCAM Protein (C-His) |
USD 366.00 |
|
TP721353 | APC Conjugated Human Trop1/EpCAM Protein (C-His) |
USD 366.00 |
|
TP721354 | Human Trop1/EpCAM Protein (C-Fc) |
USD 258.00 |
|
TP721355 | Human Trop1/EpCAM Protein (C-Fc-Avi) |
USD 258.00 |
|
TP721356 | Biotinylated Human Trop1/EpCAM Protein (C-Fc-Avi) |
USD 366.00 |
|
TP721357 | PE Conjugated Human Trop1/EpCAM Protein (C-Fc) |
USD 366.00 |
|
TP721358 | APC Conjugated Human Trop1/EpCAM Protein (C-Fc) |
USD 366.00 |
|
TP723976 | Human EPCAM Protein, His Tag |
USD 495.00 |
{0} Product Review(s)
Be the first one to submit a review