QTRT1 Rabbit Polyclonal Antibody

CAT#: TA346844

Rabbit Polyclonal Anti-QTRT1 Antibody

Product Images

WB Suggested Anti-QTRT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the N terminal of human QTRT1. Synthetic peptide located within the following region: FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: queuine tRNA-ribosyltransferase catalytic subunit 1
• Database Link:
  NP_112486
  Entrez Gene 81890 Human
  UniProt ID Q9BXR0
• Background: This gene encodes the catalytic subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine and tyrosine. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Feb 2012]
• Synonyms: FP3235; TGT; TGUT
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%; Bovine: 82%