Cblif Rabbit Polyclonal Antibody

CAT#: TA346737

Rabbit Polyclonal Anti-Gif Antibody

Product Images

Host: Rabbit; Target Name: Gif; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Gif antibody is: synthetic peptide directed towards the C-terminal region of Mouse Gif. Synthetic peptide located within the following region: LIVSSINNIAENVNHKTYWEFLSGKTPLDEGVAYYIPFNHEHITANFTQY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: gastric intrinsic factor
• Database Link:
  NP_032144
  Entrez Gene 14603 Mouse
  UniProt ID P52787
• Background: Promotes absorption of the essential vitamin cobalamin (Cbl) in the ileum. After interaction with CUBN, the GIF-cobalamin complex is internalized via receptor-mediated endocytosis.
• Synonyms: IF; IFMH; INF; TCN3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Dog: 92%