PPP2R5A Rabbit Polyclonal Antibody

CAT#: TA346501

Rabbit Polyclonal Anti-PPP2R5A Antibody

Product Images

WB Suggested Anti-PPP2R5A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: PPP2R5A; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: protein phosphatase 2 regulatory subunit B'alpha
• Database Link:
  NP_006234
  Entrez Gene 5525 Human
  UniProt ID Q15172
• Background: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes an alpha isoform of the regulatory subunit B56 subfamily. Alternative transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
• Synonyms: B56A; PR61A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Goat: 86%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Oocyte meiosis, Wnt signaling pathway