Cytokeratin 19 (KRT19) Rabbit Polyclonal Antibody

CAT#: TA346188

Rabbit Polyclonal Anti-KRT19 Antibody

Product Images

Host: Rabbit; Target Name: KRT19; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KRT19 antibody is: synthetic peptide directed towards the middle region of Human KRT19. Synthetic peptide located within the following region: DMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: keratin 19
• Database Link:
  NP_002267
  Entrez Gene 3880 Human
  UniProt ID P08727
• Background: KRT19 involved in the organization of myofibers. Together with KRT8, KRT19 helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
• Synonyms: CK19; K1CS; K19
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 92%; Bovine: 86%; Guinea pig: 85%; Goat: 77%; Sheep: 77%