U1SNRNPBP (SNRNP35) Rabbit Polyclonal Antibody

CAT#: TA345994

Rabbit Polyclonal Anti-U1SNRNPBP Antibody

Product Images

WB Suggested Anti-U1SNRNPBP Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate

• 

  Rabbit Anti-U1SNRNPBP Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-U1SNRNPBP antibody: synthetic peptide directed towards the N terminal of human U1SNRNPBP. Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: small nuclear ribonucleoprotein U11/U12 subunit 35
• Database Link:
  NP_851034
  Entrez Gene 11066 Human
  UniProt ID Q16560
• Background: U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.The protein encoded by this gene is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors. This gene is differentially expressed in a variety of human tissues. Multiple alternatively spliced transcript variants have been found for this gene, and they differ in the 5' sequence regions.
• Synonyms: HM-1; MGC138160; small nuclear ribonucleoprotein 35kDa (U11; U1 snRNP binding protein homolog; U1-snRNP binding protein homolog; U1SNRNPBP; U11; U12 snRNP 35K; U12)
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%