PRMT8 Rabbit Polyclonal Antibody

CAT#: TA345679

Rabbit Polyclonal Anti-PRMT8 Antibody

Product Images

WB Suggested Anti-PRMT8 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

• 

  Lanes: 1: 30ug HeLa lysate, 2: 30ug HFF lysate, 3: 30ug U2OS lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1: 5000; Gene Name: PRMT8

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRMT8 antibody: synthetic peptide directed towards the C terminal of human PRMT8. Synthetic peptide located within the following region: YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: protein arginine methyltransferase 8
• Database Link:
  NP_062828
  Entrez Gene 56341 Human
  UniProt ID Q9NR22
• Background: PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.
• Synonyms: HRMT1L3; HRMT1L4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome