Arntl2 Rabbit Polyclonal Antibody

CAT#: TA345279

Rabbit Polyclonal Anti-Arntl2 Antibody

Product Images

WB Suggested Anti-Arntl2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Arntl2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PHGPLPGDSAQLGFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: aryl hydrocarbon receptor nuclear translocator-like 2
• Database Link:
  NP_758513
  Entrez Gene 272322 Mouse
  UniProt ID Q2VPD4
• Background: ARNTL2/CLOCK heterodimers activate E-box element (3'-CACGTG-5') transcription. Also, in umbilical vein endothelial cells, activates SERPINE1 through E-box sites. This transactivation is inhibited by PER2 and CRY1.
• Synonyms: bHLHe6; BMAL2; CLIF; MGC149671; MGC149672; MOP9; PASD9
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%