PPP2R5E Rabbit Polyclonal Antibody

CAT#: TA345141

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Product Images

WB Suggested Anti-Ppp2r5e Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: protein phosphatase 2 regulatory subunit B'epsilon
• Database Link:
  NP_006237
  Entrez Gene 26932 Mouse
  UniProt ID Q16537
• Background: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Interacts with cyclin G in vitro.
• Synonyms: 4633401M22Rik; AI449017; B56beta; epsilon isoform; epsilon isoform of regulatory subunit B56; protein phosphatase 2; protein phosphatase 2A; protein phosphatase 2A subunit beta; regulatory subunit B (B56)
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 79%

Reference Data

• Protein Families: Druggable Genome, Phosphatase
• Protein Pathways: Oocyte meiosis, Wnt signaling pathway