C9orf40 Rabbit Polyclonal Antibody

CAT#: TA344943

Rabbit Polyclonal Anti-C9orf40 Antibody - middle region

Product Images

WB Suggested Anti-C9orf40 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: C9orf40; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: C9orf40; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C9orf40 antibody: synthetic peptide directed towards the middle region of human C9orf40. Synthetic peptide located within the following region: HNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: chromosome 9 open reading frame 40
• Database Link:
  NP_060468
  Entrez Gene 55071 Human
  UniProt ID Q8IXQ3
• Background: The function of C9orf40 remains unknown.
• Synonyms: FLJ10110; FLJ25795
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Horse: 79%