EYA3 Rabbit Polyclonal Antibody

CAT#: TA344513

Rabbit Polyclonal Anti-EYA3 Antibody - middle region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "EYA3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-EYA3 antibody is: synthetic peptide directed towards the middle region of Human EYA3. Synthetic peptide located within the following region: YQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 49 kDa
Gene Name EYA transcriptional coactivator and phosphatase 3
Background This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may act as a transcriptional activator and have a role during development. A similar protein in mice acts as a transcriptional activator.
Synonyms DKFZp686C132
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 86%; Mouse: 79%
Reference Data
Protein Families Phosphatase, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.