TSSC3 (PHLDA2) Rabbit Polyclonal Antibody

CAT#: TA344404

Rabbit Polyclonal Anti-PHLDA2 Antibody - middle region

Product Images

WB Suggested Anti-PHLDA2 Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysatePHLDA2 is supported by BioGPS gene expression data to be expressed in HT1080

• 

  Rabbit Anti-PHLDA2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Cytoplasmic and membrane; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Con

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PHLDA2 antibody: synthetic peptide directed towards the middle region of human PHLDA2. Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: pleckstrin homology like domain family A member 2
• Database Link:
  NP_003302
  Entrez Gene 7262 Human
  UniProt ID Q53GA4
• Background: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma
• Synonyms: BRW1C; BWR1C; HLDA2; IPL; TSSC3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome