Nardilysin (NRDC) Rabbit Polyclonal Antibody

CAT#: TA344218

Rabbit Polyclonal Anti-NRD1 Antibody - middle region

Product Images

WB Suggested Anti-NRD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NRD1 antibody: synthetic peptide directed towards the middle region of human NRD1. Synthetic peptide located within the following region: GSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 132 kDa
• Gene Name: nardilysin convertase
• Database Link:
  NP_001095132
  Entrez Gene 4898 Human
  UniProt ID O43847
• Background: NRD1 cleaves peptide substrates on the N-terminus of arginine residues in dibasic pairs.
• Synonyms: hNRD1; hNRD2; NRD1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Horse: 86%

Reference Data

• Protein Families: Druggable Genome, Protease