GNL3L Rabbit Polyclonal Antibody

CAT#: TA344199

Rabbit Polyclonal Anti-GNL3L Antibody - N-terminal region

Product Images

WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Lung

• 

  Rabbit Anti-GNL3L Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Nuclear in hepatocytes, moderate signal, low tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbit-Cy3;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GNL3L antibody: synthetic peptide directed towards the N terminal of human GNL3L. Synthetic peptide located within the following region: MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: G protein nucleolar 3 like
• Database Link:
  NP_061940
  Entrez Gene 54552 Human
  UniProt ID Q9NVN8
• Background: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.
• Synonyms: GNL3B
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Protease