RG9MTD1 (TRMT10C) Rabbit Polyclonal Antibody

CAT#: TA343861

Rabbit Polyclonal Anti-RG9MTD1 Antibody

Product Images

WB Suggested Anti-RG9MTD1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RG9MTD1 antibody: synthetic peptide directed towards the middle region of human RG9MTD1. Synthetic peptide located within the following region: KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: tRNA methyltransferase 10C, mitochondrial RNase P subunit
• Database Link:
  NP_060289
  Entrez Gene 54931 Human
  UniProt ID Q7L0Y3
• Background: RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
• Synonyms: COXPD30; HNYA; MRPP1; RG9MTD1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%