EXOSC7 Rabbit Polyclonal Antibody

CAT#: TA343821

Rabbit Polyclonal Anti-EXOSC7 Antibody

Product Images

WB Suggested Anti-EXOSC7 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate; EXOSC7 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-EXOSC7 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: exosome component 7
• Database Link:
  NP_055819
  Entrez Gene 23016 Human
  UniProt ID Q15024
• Background: EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
• Synonyms: EAP1; hRrp42p; p8; RRP42; Rrp42p
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation