Myeloperoxidase (MPO) Rabbit Polyclonal Antibody

CAT#: TA343091

Rabbit Polyclonal Anti-MPO Antibody

Product Images

WB Suggested Anti-MPO Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole CellMPO is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MPO antibody: synthetic peptide directed towards the N terminal of human MPO. Synthetic peptide located within the following region: QLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMCNNRRSPTLGASNRAFVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: myeloperoxidase
• Database Link:
  NP_000241
  Entrez Gene 4353 Human
  UniProt ID P05164
• Background: Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of netrophils.
• Synonyms: Myeloperoxidase
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Rat: 93%; Pig: 86%; Mouse: 86%; Guinea pig: 86%; Dog: 83%; Goat: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome