SNAP29 Rabbit Polyclonal Antibody

CAT#: TA342641

Rabbit Polyclonal Anti-SNAP29 Antibody

Product Images

WB Suggested Anti-SNAP29 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNAP29 antibody: synthetic peptide directed towards the middle region of human SNAP29. Synthetic peptide located within the following region: QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: synaptosome associated protein 29kDa
• Database Link:
  NP_004773
  Entrez Gene 9342 Human
  UniProt ID O95721
• Background: This gene, a member of the SNAP25 gene family, encodes a protein involved in multiple membrane trafficking steps. Two other members of this gene family, SNAP23 and SNAP25, encode proteins that bind a syntaxin protein and mediate synaptic vesicle membrane docking and fusion to the plasma membrane. The protein encoded by this gene binds tightly to multiple syntaxins and is localized to intracellular membrane structures rather than to the plasma membrane. While the protein is mostly membrane-bound, a significant fraction of it is found free in the cytoplasm. Use of multiple polyadenylation sites has been noted for this gene.
• Synonyms: CEDNIK; SNAP-29
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: SNARE interactions in vesicular transport