THG1L Rabbit Polyclonal Antibody

CAT#: TA342532

Rabbit Polyclonal Anti-Thg1l Antibody

Product Images

WB Suggested Anti-Thg1l Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Thg1l antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: tRNA-histidine guanylyltransferase 1 like
• Database Link:
  NP_060342
  Entrez Gene 66628 Mouse
  UniProt ID Q9NWX6
• Background: Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis.
• Synonyms: hTHG1; ICF45; IHG-1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 92%; Bovine: 86%; Zebrafish: 82%